PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_1_00789
Common NameCHLNCDRAFT_133653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family CO-like
Protein Properties Length: 678aa    MW: 67037 Da    PI: 8.3619
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_1_00789genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.31.4e-071758541
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                     C +++   ++l+C+ ++ +lC+ C  + H++      H++vp
  IGS.gm_1_00789 17 PCVLCHAP-ASLYCRADDAYLCAGCDAHLHSSsaimaaHERVP 58
                    79***966.*********************8899999999987 PP

2CCT58.32.8e-20615657143
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                     R+++l+RY+ K+ +RkF+ ++rY++RK +A+ RpR+KGrFv+ 
  IGS.gm_1_00789 615 RAEKLERYRAKKLRRKFQPTVRYQCRKHYADMRPRIKGRFVSP 657
                     99***************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.0151359IPR000315B-box-type zinc finger
PfamPF006435.8E-61758IPR000315B-box-type zinc finger
CDDcd000214.01E-51758No hitNo description
PfamPF062034.0E-17615656IPR010402CCT domain
PROSITE profilePS5101713.86615657IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MHGGAADAAL RGLTASPCVL CHAPASLYCR ADDAYLCAGC DAHLHSSSAI MAAHERVPAA  60
CRPGLPAGGG ASSARQPSPQ PQALRHEPPG PGLAGVMAAA AGAVQQYTQQ YTQQYKSCLL  120
SSGPTSASPF CFLSKQLLPP PPLPQQPGDA WAAAGGAGAS LRHGSAGSDD TRWEAAAAPP  180
AARGGSLDAV LMDCLEGLAH ADGSTLLDFN LELAQLPTLG LAGRRAGAPA SQPGLQQPPA  240
HAVAEAEAGV EAEADVEMIH GVGAAGSGGL SGHCQVACPA AAATQHHHHH HHHQQEAGPA  300
LAGSLFEGRC QQAHAQAQQQ QAQQQLAAGL LPAELRETAD RLLLGPTLQP PPDREAGSGL  360
LQREPSCGLP PPPASSSSRQ WALVTTGSSG SGTPPPPPTA TAAGEALAEM ASGLWPREPS  420
GSLLLPPAGG GSGVLLHGSS SGAAAAQPAA MVAVTTGGGF GGAAAAPATA APGPSSVTTG  480
LQPPAGLHAA ATAAAAAPTK RGGKADRRRG GGSGRGQRMP GGATGSGGGG SPGKGLPGGA  540
AVRRPTRPAA LSAAVKVAAT AAAEAAGEGS AAAAAAAAAA AAARARRAAG VEAGGEGSDG  600
ALCIVIPPYR EGETRAEKLE RYRAKKLRRK FQPTVRYQCR KHYADMRPRI KGRFVSPEEF  660
AAWQAQEQAG GGARAAC*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005852267.10.0hypothetical protein CHLNCDRAFT_133653
TrEMBLE1Z3I80.0E1Z3I8_CHLVA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP6111112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.18e-10CONSTANS-like 3
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]